[engineering · life · the sky]
I write about building dependable systems, working alongside AI, protecting privacy, and the life beyond the screen that sharpens how I see and build.
[outward from the core · newest first]
Production systems sit beside the observations that sharpen how I think: family, travel, photography, reflection, and the night sky.
A public-safe account of my Android work across multichain rewards, transaction replacement, wallet migration, swaps, shared Rust, startup performance, and release reliability.
Bitcoin.com WalletAndroidFintechMultichainRust
How I delivered ITVX Android player features at Candyspace across recommendations, timeline previews, phone and tablet motion, reliability, security, and XML parsing.
CandyspaceITVXAndroidStreamingMedia Playback
I’m not a web developer, but with Codex I turned a static portfolio into a working orbital interface—and spent more time shaping the product than wrestling with syntax.
ai-workflowproduct-engineeringweb-animationuxaccessibilityquality-engineeringcross-disciplinary-engineering
We have become fluent in naming what hurts. But awareness can become another form of avoidance when it never turns into care, accountability, or action.
Mental HealthSelf-AwarenessPersonal ResponsibilityCultural Critique
A reflection on the defenses we build from old wounds, pride, and habit—and why real change begins when we stop guarding what keeps us trapped.
Self-AwarenessPersonal GrowthAccountabilityHealing
Lessons from a compact backend: explicit API contracts, append-only location history, PostGIS semantics, guarded AI prose, and evidence-based verification.
kotlinspring-bootpostgisbackendai-engineeringprivacytestingsystems-design
A practical reflection on local agents, memory, verification, and the handoffs that let the next run trust what happened.
ai-workflowlocal-agentsengineering-disciplineandroidmemory-systemsdelivery
How I set up MemPalace as a practical tool for local agents: small taxonomy, verify-first retrieval, agent diaries, AAAK wake-up context, and why protocol matters more than storage.
ai-workflowmempalacelocal-agentsmemory-systemsmcp
How a Rust facade, UniFFI bindings, and platform packaging can give Android and iOS one domain core without duplicating behavior.
rustmobilearchitectureandroidiosuniffiffi
A practical framework for reading engineering growth through scope, decision quality, operational responsibility, and durable outcomes.
careerleadershipplatform-ownershipdeliveryengineering-growth
How I use two assessment profiles as prompts for better decisions and communication—without treating their scores as identity or proof of ability.
emergeneticsharrisonparadoxself-awarenessleadership
A practical quality loop for static personal sites: verify the publication boundary, exercise critical routes, and review desktop and mobile rendering.
qualitye2eplaywrightqafrontend
How SQLite authoring, deterministic static generation, and a public-only build artifact create an editable blog without shipping a runtime database.
site-architecturesqlitegithub-pagesseocontent-system
How agentic tools widened my engineering workflow without replacing mobile depth, explicit ownership, or evidence-based delivery.
ai-workflowengineeringdeliveryscopesystems-thinking
A practical prompt structure for coding agents: live context, real constraints, side-effect boundaries, observable acceptance evidence, and reproducible handoffs.
ai-workflowpromptingengineeringdeliveryquality
Lessons from multi-agent engineering work: define output contracts, instrument repeated effort, match verification to risk, and preserve trustworthy handoffs.
AI OpsPrompt EngineeringTeam Process
Family holidays in Auckland, a compressed South Island road trip, and the surprise of catching the Aurora Australis.
TravelFamilyReflection
I led five senior Android engineers on MySTC, working in Kotlin and Java across account, ordering, support, and multilingual flows.
MySTCAndroidKotlinTelecom
A personal essay about designing focus blocks, protecting rest, and keeping philosophy close to the shipping calendar.
PhilosophyCreative Process
I worked on OCBC Business for Android in Kotlin and XML, covering chart UI, identity-verification integration, network behavior, and focused unit tests.
OCBCFintechAndroidKotlin
Three frames from one trip, one ongoing experiment: motion, moon detail, and mountain light across different gear and shooting constraints.
Photography
I worked on openpay's Android purchase flow, including spend-limit cards, merchant content, checkout state, and partner-dependent payment paths.
openpayFintechBNPLAndroidCheckout
I worked in Solo's shared Kotlin and XML codebase, shipping Android features and production fixes used by multiple restaurant-branded apps.
SoloFood DeliveryAndroidWhitelabel
I led delivery across OWTO's Android, iOS, and backend work and stayed hands-on with booking, GPS, payments, and the APIs connecting them.
OWTOMobilityAndroidiOSBackend
A practical way to divide shared domain behavior, state, packaging, and native UI responsibilities across Kotlin and Swift.
KMPSwiftUI
I built and evaluated Android experiment variants for Popslide and worked on lockscreen behavior, notifications, caching, and production state handling.
PopslideAdtechAndroidExperimentation
I worked on WebSafety features across Java and Objective-C code, including GPS, synchronization, permissions, and platform behavior that wasn't always documented.
WebSafetySecurityParental ControlsAndroid
I contributed Kotlin feature and maintenance work to ProjectBASS, an open-source Android app for collecting volunteer network measurements.
ProjectBASSOpen SourceNetwork MappingKotlin
No writing matches that subject yet.
[28 published entries · engineering, systems, and life]